| Edit |   |
| Antigenic Specificity | F-box protein 15/FBXO15 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The F-box protein 15/FBXO15 Antibody from Novus Biologicals is a rabbit polyclonal antibody to F-box protein 15/FBXO15. This antibody reacts with human. The F-box protein 15/FBXO15 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to FBXO15(F-box protein 15) The peptide sequence was selected from the N terminal of FBXO15. Peptide sequence QDKEAGYWKKEYITKQIASVKAALADILKPVNPYTGLPVKTKEALRIFGL. |
| Other Names | F-box only protein 15, F-box protein 15, FBX15MGC39671 |
| Gene, Accession # | FBXO15, Gene ID: 201456, Accession: Q8NCQ5, SwissProt: Q8NCQ5 |
| Catalog # | NBP1-56901-20ul |
| Price | |
| Order / More Info | F-box protein 15/FBXO15 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |