Edit |   |
Antigenic Specificity | DPM2 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human (antigen sequence identity: mouse 38%, rat 38%) |
Isotype | n/a |
Format | antigen affinity purified |
Size | 100 µl |
Concentration | n/a |
Applications | IHC |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-human DPM2 polyclonal antibody. |
Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: SSPPPLDPGQGFGKTPPLNMLPHFGGAGSCLPRTHPWGFPVHPSRLPVSNLWVSWC |
Other Names | dolichyl-phosphate mannosyltransferase polypeptide 2, regulatory subunit, MGC111193, MGC21559 |
Gene, Accession # | Gene ID: 8818, UniProt: None, ENSG00000136908 |
Catalog # | HPA064623 |
Price | |
Order / More Info | DPM2 Antibody from ATLAS ANTIBODIES AB |
Product Specific References | n/a |