| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ADAT2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ADAT2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ADAT2. This antibody reacts with human. The ADAT2 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human ADAT2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PKPAASGACSVSAEETEKWMEEAMHMAKEALENTEVPVGCLMVYNNEVVGKGRNEVNQTKNATRHAEMVAIDQVLDWCRQSGKSPSEVFE |
|---|
| Other Names | adenosine deaminase, tRNA-specific 2, TAD2 homolog (S. cerevisiae), DEADC1, deaminase domain containing 1, Deaminase domain-containing protein 1, dJ20N2, dJ20N2.1, DKFZp686L1118, EC 3.5.4, EC 3.5.4.-, FLJ44213, TAD2, tRNA-specific adenosine deaminase 2, tRNA-specific adenosine deaminase 2 homolog, tRNA-specific adenosine-34 deaminase subunit ADAT2 |
|---|
| Gene, Accession # | ADAT2, Gene ID: 134637, Accession: Q7Z6V5, SwissProt: Q7Z6V5 |
|---|
| Catalog # | NBP1-84285 |
|---|
| Price | |
|---|
| Order / More Info | ADAT2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|