| 产品详情 |
| Edit |   |
| Antigenic Specificity | ADE2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat, Chinese hamster |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ADE2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ADE2. This antibody reacts with human, mouse, rat, chinese hamster. The ADE2 Antibody has been validated for the following applications: Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of ADE2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ETAFIAPQCEMIPIEWVCRRIATGSFLKRNPGVKEGYKFYPPKVELFFKDDANNDPQWSEEQLIAAKFCFAGLLIGQTEVDIMS |
| Other Names | ADE2, AIR carboxylase, AIRCADE2H1, DKFZp781N1372, MGC1343, MGC5024, multifunctional protein ADE2, PAIS, phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazolesuccinocarboxamide synthetase, SAICAR synthetase |
| Gene, Accession # | PAICS, Gene ID: 10606, Accession: P22234, SwissProt: P22234 |
| Catalog # | NBP1-90235 |
| Price | |
| Order / More Info | ADE2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 23394948, 23405267, 25869206 |
| 产品资料 |
|
|