Edit |   |
Antigenic Specificity | MAST1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human (antigen sequence identity: mouse 98%, rat 98%) |
Isotype | n/a |
Format | antigen affinity purified |
Size | 100 µl |
Concentration | n/a |
Applications | IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-human MAST1 polyclonal antibody. |
Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: LTLREKTWRGGSPEIKRFSASEASFLEGEASPPLGARRRFSALLEPSRFSAPQEDEDE |
Other Names | microtubule associated serine/threonine kinase 1, KIAA0973, SAST |
Gene, Accession # | Gene ID: 22983, UniProt: Q9Y2H9, ENSG00000105613 |
Catalog # | HPA073106 |
Price | |
Order / More Info | MAST1 Antibody from ATLAS ANTIBODIES AB |
Product Specific References | n/a |