| 产品详情 |
| Edit |   |
| Antigenic Specificity | Ku70/XRCC6 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Ku70/XRCC6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Ku70/XRCC6. This antibody reacts with human. The Ku70/XRCC6 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated. Specificity of human Ku70/XRCC6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: PPYFVALVPQEEELDDQKIQVTPPGFQLVFLPFADDKRKMPFTEKIMATPEQVGKMKAIVEKLRFTYRSDSFENPVLQQHFRNLEALALDLMEPEQAVDL |
| Other Names | 5'-deoxyribose-5-phosphate lyase Ku70, 5'-dRP lyase Ku70, 70 kDa subunit of Ku antigen, ATP-dependent DNA helicase 2 subunit 1, ATP-dependent DNA helicase II 70 kDa subunit, CTC box binding factor 75 kDa subunit, CTC box-binding factor 75 kDa subunit, CTC75, CTCBF, D22S731, EC 3.6.4.-, EC 4.2.99.-, G22P1Ku70, Ku autoantigen p70 subunit, Ku autoantigen, 70kDa, KU70, ML8,70 kDa subunit, Thyroid-lupus autoantigen, thyroid-lupus autoantigen p70, TLAAD22S671, X-ray repair complementing defective repair in Chinese hamster cells 6DNA repair protein XRCC6, X-ray repair cross-complementing protein 6 |
| Gene, Accession # | XRCC6, Gene ID: 2547, Accession: P12956, SwissProt: P12956 |
| Catalog # | NBP2-38567 |
| Price | |
| Order / More Info | Ku70/XRCC6 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|