| 产品详情 |
| Edit |   |
| Antigenic Specificity | DDIT4 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The DDIT4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DDIT4. This antibody reacts with human. The DDIT4 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human DDIT4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QLLQESLAQARLGSRRPARLLMPSQLVSQVGKELLRLAYSEPCGLRGALLDVCVEQGKSCHSVGQLALD |
| Other Names | Dig2, DNA-damage-inducible transcript 4, FLJ20500, HIF-1 responsive RTP801 (RTP801), Protein regulated in development and DNA damage response 1, REDD-1DNA damage-inducible transcript 4 protein, REDD1HIF-1 responsive protein RTP801, RTP801RP11-442H21.1 |
| Gene, Accession # | DDIT4, Gene ID: 54541 |
| Catalog # | NBP1-85211 |
| Price | |
| Order / More Info | DDIT4 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 23435261 |
| 产品资料 |
|
|