| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MRGPRF |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MRGPRF Antibody from Novus Biologicals is a rabbit polyclonal antibody to MRGPRF. This antibody reacts with human. The MRGPRF Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human MRGPRF antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MAGNCSWEAHPGNRNRMCPGLSEAPELYSRGFLTIEQIAMLP |
|---|
| Other Names | FLJ16111, FLJ29034, FLJ40998, FLJ53714, G protein-coupled receptor 140, G protein-coupled receptor 168, G protein-coupled receptor MrgF, GPR140, GPR168, G-protein coupled receptor 140, G-protein coupled receptor 168, mas-related G protein-coupled MRGF, Mas-related gene F protein, MAS-related GPR, member F, mas-related G-protein coupled receptor member F, MGC21621, mrgF, MRGFDKFZp586B2122, RTA, seven transmembrane helix receptor |
|---|
| Gene, Accession # | MRGPRF, Gene ID: 116535 |
|---|
| Catalog # | NBP1-83341 |
|---|
| Price | |
|---|
| Order / More Info | MRGPRF Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|