| 产品详情 |
| Edit |   |
| Antigenic Specificity | RPL13 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The RPL13 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RPL13. This antibody reacts with human. The RPL13 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated. Specificity of human RPL13 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PKKGDSSAEELKLATQLTGPVMPVRNVYKKEKARVITEEEKNFKAFASLR MARANARLFGIRAKRAKEAAEQD |
| Other Names | BBC1FLJ27454, Breast basic conserved protein 1, D16S444E, FLJ27453, MGC117342, MGC71373,60S ribosomal protein L13, OK/SW-cl.46, ribosomal protein L13 |
| Gene, Accession # | RPL13, Gene ID: 6137 |
| Catalog # | NBP2-13250 |
| Price | |
| Order / More Info | RPL13 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|