| Edit |   |
|---|
| Antigenic Specificity | RPL18 |
|---|
| Clone | 3D5 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RPL18 Antibody (3D5) from Novus Biologicals is a mouse monoclonal antibody to RPL18. This antibody reacts with human. The RPL18 Antibody (3D5) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | RPL18 (NP_000970, 90 a.a. - 188 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VRVQEVPKLKVCALRVTSRARSRILRAGGKILTFDQLALDSPKGCGTVLLSGPRKGREVYRHFGKAPGTPHSHTKPYVRSKGRKFERARGRRASRGYKN |
|---|
| Other Names | ribosomal protein L18,60S ribosomal protein L18 |
|---|
| Gene, Accession # | RPL18, Gene ID: 6141, Accession: NP_000970, SwissProt: NP_000970 |
|---|
| Catalog # | H00006141-M01 |
|---|
| Price | |
|---|
| Order / More Info | RPL18 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|