| 产品详情 |
| Edit |   |
| Antigenic Specificity | CREB3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CREB3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CREB3. This antibody reacts with human. The CREB3 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human CREB3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VLKYTAQNMELQNKVQLLEEQNLSLLDQLRKLQAMVIEISNKTS |
| Other Names | basic leucine zipper protein, cAMP responsive element binding protein 3, cAMP responsive element binding protein 3 (luman), cAMP-responsive element-binding protein 3, CREB-3, cyclic AMP response element (CRE)-binding protein/activating transcriptionfactor 1, cyclic AMP-responsive element-binding protein 3, LUMAN, LZIPMGC15333, MGC19782, Transcription factor LZIP-alpha |
| Gene, Accession # | CREB3, Gene ID: 10488 |
| Catalog # | NBP2-58307 |
| Price | |
| Order / More Info | CREB3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|