| Edit |   |
| Antigenic Specificity | ASTE1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | mouse |
| Isotype | n/a |
| Format | immunogen affinity purified, no preservative |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ASTE1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ASTE1. This antibody reacts with mouse. The ASTE1 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the middle region of human Aste1. Peptide sequence YHRVLGLLNWLSHFDDPTEALDNVLKSLPKKSRENVKELLCCSMEEYQQS. |
| Other Names | asteroid homolog 1 (Drosophila), HT001, MGC129980, protein asteroid homolog 1 |
| Gene, Accession # | ASTE1, Gene ID: 28990, Accession: NP_079927 |
| Catalog # | NBP1-80291-20ul |
| Price | |
| Order / More Info | ASTE1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |