| Edit |   |
|---|
| Antigenic Specificity | ASTE1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ASTE1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ASTE1. This antibody reacts with mouse. The ASTE1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the middle region of human Aste1. Peptide sequence YHRVLGLLNWLSHFDDPTEALDNVLKSLPKKSRENVKELLCCSMEEYQQS. |
|---|
| Other Names | asteroid homolog 1 (Drosophila), HT001, MGC129980, protein asteroid homolog 1 |
|---|
| Gene, Accession # | ASTE1, Gene ID: 28990, Accession: NP_079927 |
|---|
| Catalog # | NBP1-80291 |
|---|
| Price | |
|---|
| Order / More Info | ASTE1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|