| Edit |   |
|---|
| Antigenic Specificity | ASXL2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ASXL2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ASXL2. This antibody reacts with human. The ASXL2 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human ASXL2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PKSMPVSEASLIRIVPVVSQSECKEEALQMSSPGRKEECESQGEVQPNFSTSSEPLLSSALNTHELSSILPIKCPKDE |
|---|
| Other Names | additional sex combs like 2 (Drosophila), Additional sex combs-like protein 2, ASXH2polycomb group protein ASXH2, FLJ10898, KIAA1685DKFZp686C1968, putative Polycomb group protein ASXL2 |
|---|
| Gene, Accession # | ASXL2, Gene ID: 55252 |
|---|
| Catalog # | NBP2-56782 |
|---|
| Price | |
|---|
| Order / More Info | ASXL2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|