| Edit |   |
|---|
| Antigenic Specificity | DDT |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DDT Antibody from Novus Biologicals is a rabbit polyclonal antibody to DDT. This antibody reacts with human. The DDT Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to DDT(D-dopachrome tautomerase) The peptide sequence was selected from the N terminal of DDT. Peptide sequence PFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALS. |
|---|
| Other Names | D-dopachrome decarboxylase, D-dopachrome tautomeraseDDCT, EC 4.1.1.84, Phenylpyruvate tautomerase II |
|---|
| Gene, Accession # | DDT, Gene ID: 1652, Accession: B5MCS6, SwissProt: B5MCS6 |
|---|
| Catalog # | NBP1-53202 |
|---|
| Price | |
|---|
| Order / More Info | DDT Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|