| 产品详情 |
| Edit |   |
| Antigenic Specificity | ASZ1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ASZ1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ASZ1. This antibody reacts with human. The ASZ1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human ASZ1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DGHTQVVALLVAHGAEVNTQDENGYTALTWAARQGHKNIVLKLLELGANKMLQTKDGKMPSEIAKRNKHHEIFNLLSFTLNPLEGKLQQLTKED |
| Other Names | ALP1Germ cell-specific ankyrin, SAM and basic leucine zipper domain-containingprotein, ANKL14933400N19Rik, ankyrin repeat, SAM and basic leucine zipper domain containing 1, ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1, ankyrin-like 1, Ankyrin-like protein 1, CT1.19, GASZC7orf7, MGC26634, Orf3 |
| Gene, Accession # | ASZ1, Gene ID: 136991 |
| Catalog # | NBP1-89130 |
| Price | |
| Order / More Info | ASZ1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|