| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SAP155 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SAP155 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SAP155. This antibody reacts with human. The SAP155 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. This product is specific to Subunit or Isoform: 1 |
|---|
| Immunogen | Synthetic peptides corresponding to SF3B1 (splicing factor 3b, subunit 1, 155kDa) The peptide sequence was selected from the middle region of SF3B1. Peptide sequence LLNDIPQSTEQYDPFAEHRPPKIADREDEYKKHRRTMIISPERLDPFADG. |
|---|
| Other Names | Hsh155, pre-mRNA processing 10, pre-mRNA splicing factor SF3b, 155 kDa subunit, Pre-mRNA-splicing factor SF3b 155 kDa subunit, Prp10, PRPF10, SAP 155, SAP155splicing factor 3b, subunit 1, 155kD, SF3B155, SF3b155PRP10, spliceosome associated protein 155, Spliceosome-associated protein 155, splicing factor 3B subunit 1, splicing factor 3b, subunit 1, 155kDa |
|---|
| Gene, Accession # | SF3B1, Gene ID: 23451 |
|---|
| Catalog # | NBP1-57192 |
|---|
| Price | |
|---|
| Order / More Info | SAP155 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|