| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SAP25 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SAP25 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SAP25. This antibody reacts with human. The SAP25 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human SAP25 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: TGHWNGQQAPPDAGFPVVCCEDVFLSDPLLPRGQRVPLYLSKAPQQMMGSL |
|---|
| Other Names | 25 KDa Sin3-Associated Polypeptide, Histone Deacetylase Complex Subunit SAP25, Sin3 Corepressor Complex Subunit SAP25, Sin3A-Associated Protein, 25kDa, Sin3A-Binding Protein 25, Sin3-Associated Polypeptide, 25kDa |
|---|
| Gene, Accession # | Gene ID: 100316904 |
|---|
| Catalog # | NBP2-32365 |
|---|
| Price | |
|---|
| Order / More Info | SAP25 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 30428638 |
|---|
| 产品资料 |
|
|