| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SAP30 |
|---|
| Clone | 4D2 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2b kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Antibody reactivity against recombinant protein for WB. It has been used for IHC-P and ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SAP30 Antibody (4D2) from Novus Biologicals is a mouse monoclonal antibody to SAP30. This antibody reacts with human. The SAP30 Antibody (4D2) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | SAP30 (NP_003855, 131 a.a. - 219 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SDDDGGDSPVQDIDTPEVDLYQLQVNTLRRYKRHFKLPTRPGLNKAQLVEIVGCHFRSIPVNEKDTLTYFIYSVKNDKNKSDLKVDSGV |
|---|
| Other Names | 30 kDa Sin3-associated polypeptide, histone deacetylase complex subunit SAP30, Sin3 corepressor complex subunit SAP30, Sin3A-associated protein, 30kDa, Sin3-associated polypeptide p30, sin3-associated polypeptide, 30 kDa, Sin3-associated polypeptide, 30kDa |
|---|
| Gene, Accession # | SAP30, Gene ID: 8819, Accession: NP_003855, SwissProt: NP_003855 |
|---|
| Catalog # | H00008819-M02 |
|---|
| Price | |
|---|
| Order / More Info | SAP30 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|