| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | OSBPL5 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The OSBPL5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to OSBPL5. This antibody reacts with human. The OSBPL5 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human OSBPL5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LCGLPASATVHPDQDLFPLNGSSLENDAFSDKSERENPEESDTETQDHSRKTESGSDQSETPGAPVRRGTTYVEQVQEEL |
|---|
| Other Names | EC 1.2.1, EC 2.7.7.6, FLJ42929, KIAA1534oxysterol-binding protein-related protein 5, OBPH1, ORP-5, ORP5oxysterol-binding protein homologue 1, OSBP-related protein 5, oxysterol binding protein-like 5, oxysterol-binding protein homolog 1, Oxysterol-binding protein homolog 1; |
|---|
| Gene, Accession # | OSBPL5, Gene ID: 114879 |
|---|
| Catalog # | NBP2-55591 |
|---|
| Price | |
|---|
| Order / More Info | OSBPL5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|