| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CEP350 |
|---|
| Clone | CL3423 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG1 |
|---|
| Format | Protein A purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CEP350 Antibody (CL3423) from Novus Biologicals is a mouse monoclonal antibody to CEP350. This antibody reacts with human. The CEP350 Antibody (CL3423) has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human CEP350 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QVVQSQREVTEVLQEATCKIAAQQSETARLTTDAARQICEMAELTRTHISDAVVASGAPLAILYDHQRQHLPDFVKQLRTRTETDRKSPSVSLSQ |
|---|
| Other Names | CAP350GM133, centrosomal protein 350kDa, centrosome-associated protein 350, Centrosome-associated protein of 350 kDa, Cep350, FLJ38282, FLJ44058, KIAA0480centrosome associated protein 350 |
|---|
| Gene, Accession # | CEP350, Gene ID: 9857 |
|---|
| Catalog # | NBP2-59028 |
|---|
| Price | |
|---|
| Order / More Info | CEP350 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|