| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | FIP1L1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FIP1L1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to FIP1L1. This antibody reacts with human. The FIP1L1 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human FIP1L1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DVHVTIGDIKTGAPQYGSYGTAPVNLNIKTGGRVYGTTGTKVKGVDLDAPGSINGVPLLEVDLDSFEDKPWRKPGADLSDYFNYGFNEDTWK |
|---|
| Other Names | DKFZp586K0717, EC 1.1.1.86, EC 4.2.1.33, Factor interacting with PAP, FIP1, FIP1 like 1 (S. cerevisiae), FIP1-like 1 protein, FLJ33619, hFip1, pre-mRNA 3'-end-processing factor FIP1, Rearranged in hypereosinophilia, Rhe |
|---|
| Gene, Accession # | FIP1L1, Gene ID: 81608 |
|---|
| Catalog # | NBP2-55078 |
|---|
| Price | |
|---|
| Order / More Info | FIP1L1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|