| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | FIP1/RCP |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FIP1/RCP Antibody from Novus Biologicals is a rabbit polyclonal antibody to FIP1/RCP. This antibody reacts with human. The FIP1/RCP Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human FIP1/RCP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TGSAKHRLHPVKPMNAMATKVANCSLGTATIISENLNNEVMMKKYSPSDPAFAYAQLTHDELIQLVLKQKETISKKEFQVR |
|---|
| Other Names | DKFZp686E2214, EC 3.2.1.28, EC 6.1.1.7, FLJ22524, FLJ22622, MGC78448, NOEL1A, RAB11 coupling protein, RAB11 family interacting protein 1 (class I), rab11 family-interacting protein 1, Rab11-FIP1, Rab-coupling protein, Rab-interacting recycling protein, RCPRab effector protein |
|---|
| Gene, Accession # | RAB11FIP1, Gene ID: 80223 |
|---|
| Catalog # | NBP1-83599 |
|---|
| Price | |
|---|
| Order / More Info | FIP1/RCP Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|