| Edit |   |
|---|
| Antigenic Specificity | Plasmolipin |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Plasmolipin Antibody from Novus Biologicals is a rabbit polyclonal antibody to Plasmolipin. This antibody reacts with human. The Plasmolipin Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Plasmolipin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MAEFPSKVSTRTSSPAQGAEASVSALRPDLGFVRS |
|---|
| Other Names | Plasma membrane proteolipid, plasmolipin, PMLPTM4SF11plasma membrane proteolipid (plasmolipin), transmembrane 4 superfamily member 11 (plasmolipin) |
|---|
| Gene, Accession # | PLLP, Gene ID: 51090 |
|---|
| Catalog # | NBP2-13777 |
|---|
| Price | |
|---|
| Order / More Info | Plasmolipin Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|