| 产品详情 |
| Edit |   |
| Antigenic Specificity | PLC-beta 1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PLC-beta 1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PLC-beta 1. This antibody reacts with human. The PLC-beta 1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human PLC-beta 1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: NKKKSHKSSEGSGKKKLSEQASNTYSDSSSMFEPSSPGAGEADTESDDDDDDDDCKKSSMDEGTAGSEAMATEEMSNLVN |
| Other Names | EC 3.1.4.11, EIEE12, FLJ45792, inositoltrisphosphohydrolase, KIAA05811-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta 1, monophosphatidylinositol phosphodiesterase, phosphoinositidase C, Phosphoinositide phospholipase C-beta-1, phospholipase C, beta 1 (phosphoinositide-specific), Phospholipase C-beta-1, Phospholipase C-I, PI-PLC, PLC-154, PLC154,1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-1, PLCB1A, PLCB1B, PLC-beta-1, PLC-I1-phosphatidyl-D-myo-inositol-4,5-bisphosphate, triphosphoinositide phosphodiesterase |
| Gene, Accession # | PLCB1, Gene ID: 23236, Accession: Q9NQ66, SwissProt: Q9NQ66 |
| Catalog # | NBP2-38220 |
| Price | |
| Order / More Info | PLC-beta 1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|