| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PLC-beta 1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PLC-beta 1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PLC-beta 1. This antibody reacts with human. The PLC-beta 1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to PLCB1(phospholipase C, beta 1 (phosphoinositide-specific)) The peptide sequence was selected from the middle region of PLCB1. Peptide sequence EAQSKRQEKLVEKHKEIRQQILDEKPKGEGSSSFLSETCHEDPSVSPNFT. |
|---|
| Other Names | EC 3.1.4.11, EIEE12, FLJ45792, inositoltrisphosphohydrolase, KIAA05811-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta 1, monophosphatidylinositol phosphodiesterase, phosphoinositidase C, Phosphoinositide phospholipase C-beta-1, phospholipase C, beta 1 (phosphoinositide-specific), Phospholipase C-beta-1, Phospholipase C-I, PI-PLC, PLC-154, PLC154,1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-1, PLCB1A, PLCB1B, PLC-beta-1, PLC-I1-phosphatidyl-D-myo-inositol-4,5-bisphosphate, triphosphoinositide phosphodiesterase |
|---|
| Gene, Accession # | PLCB1, Gene ID: 23236, Accession: D3DW13, SwissProt: D3DW13 |
|---|
| Catalog # | NBP1-58257 |
|---|
| Price | |
|---|
| Order / More Info | PLC-beta 1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|