| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PLC-beta 3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PLC-beta 3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PLC-beta 3. This antibody reacts with human. The PLC-beta 3 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human PLC-beta 3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: RILVKNKKRHRPSAGGPDSAGRKRPLEQSNSALSESSAATEPSSPQLGSPSSDSCPGLSNGEEVGLEKPSLEPQKSLGDEGLNRGPYVLGPADR |
|---|
| Other Names | 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-3, EC 3.1.4.11, FLJ37084, Phosphoinositide phospholipase C-beta-3, phospholipase C, beta 3 (phosphatidylinositol-specific), Phospholipase C-beta-3, PLC beta 3, PLC-beta-3 |
|---|
| Gene, Accession # | PLCB3, Gene ID: 5331, Accession: Q01970, SwissProt: Q01970 |
|---|
| Catalog # | NBP2-32026 |
|---|
| Price | |
|---|
| Order / More Info | PLC-beta 3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|