| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Spt6 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Spt6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Spt6. This antibody reacts with human. The Spt6 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Spt6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: RTTYIKRVIAHPSFHNINFKQAEKMMETMDQGDVIIRPSSKGENHLTVTWKVSDGIYQHVDVREEGKENAFSLGATLWINSEEFEDLDEIVARYVQPM |
|---|
| Other Names | emb-5, hSPT6, KIAA0162MGC87943, SPT6HSPT6, suppressor of Ty (S.cerevisiae) 6 homolog, suppressor of Ty 6 homolog (S. cerevisiae), Tat-cotransactivator 2 protein, Tat-CT2 protein, transcription elongation factor SPT6 |
|---|
| Gene, Accession # | SUPT6H, Gene ID: 6830, Accession: Q7KZ85, SwissProt: Q7KZ85 |
|---|
| Catalog # | NBP2-34030 |
|---|
| Price | |
|---|
| Order / More Info | Spt6 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|