| 产品详情 |
| Edit |   |
| Antigenic Specificity | TRIM23 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry-Paraffin. IP, WB reported in scientific literature (PMID: 25905670). For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TRIM23 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TRIM23. This antibody reacts with human. The TRIM23 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry-Paraffin. Specificity of human TRIM23 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LGDSGVWGLKKNFALLELLERLQNGPIGQYGAAEESIGISGESITRCDEDEAHLASVYCTVCATHLCSECSQVTHST |
| Other Names | ADP-ribosylation factor domain protein 1, 64kDa, ADP-ribosylation factor domain-containing protein 1, ARD1GTP-binding protein ARD-1, ARF domain protein 1, ARFD1, E3 ubiquitin-protein ligase TRIM23, EC 6.3.2.-, RNF46RING finger protein 46, tripartite motif containing 23, tripartite motif protein TRIM23, tripartite motif-containing 23, Tripartite motif-containing protein 23 |
| Gene, Accession # | TRIM23, Gene ID: 373 |
| Catalog # | NBP1-88846 |
| Price | |
| Order / More Info | TRIM23 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 25905670 |
| 产品资料 |
|
|