| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TRIM26 |
|---|
| Clone | 1G3 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TRIM26 Antibody (1G3) from Novus Biologicals is a mouse monoclonal antibody to TRIM26. This antibody reacts with human. The TRIM26 Antibody (1G3) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | TRIM26 (NP_003440.1 146 a.a. - 240 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. REKILNHLSTLRRDRDKIQGFQAKGEADILAALKKLQDQRQYIVAEFEQGHQFLREREEHLLEQLAKLEQELTEGREKFKSRGVGELARLALVIS |
|---|
| Other Names | Acid finger protein, AFP, RNF95RING finger protein 95, tripartite motif containing 26, tripartite motif-containing protein 26, widely expressed acid zinc finger protein, Zinc finger protein 173, ZNF173tripartite motif-containing 26 |
|---|
| Gene, Accession # | TRIM26, Gene ID: 7726, Accession: NP_003440, SwissProt: NP_003440 |
|---|
| Catalog # | H00007726-M01 |
|---|
| Price | |
|---|
| Order / More Info | TRIM26 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|