| Edit |   |
| Antigenic Specificity | TSPYL6 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TSPYL6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TSPYL6. This antibody reacts with human. The TSPYL6 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to TSPYL6 (TSPY-like 6) The peptide sequence was selected from the N terminal of TSPYL6. Peptide sequence MSLPESPHSPATLDYALEDPHQGQRSREKSKATEVMADMFDGRLEPIVFP. |
| Other Names | DKFZp434B125, testis-specific Y-encoded-like protein 6, TSPY-like 6, TSPY-like protein 6 |
| Gene, Accession # | TSPYL6, Gene ID: 388951, Accession: Q8N831, SwissProt: Q8N831 |
| Catalog # | NBP1-52869 |
| Price | |
| Order / More Info | TSPYL6 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |