| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | HFE |
|---|
| Clone | 1G12 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG1 kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The HFE Antibody (1G12) from Novus Biologicals is a mouse monoclonal antibody to HFE. This antibody reacts with human. The HFE Antibody (1G12) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. |
|---|
| Immunogen | HFE (NP_000401 115 a.a. - 205 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SHTLQVILGCEMQEDNSTEGYWKYGYDGQDHLEFCPDTLDWRAAEPRAWPTKLEWERHKIRARQNRAYLERDCPAQLQQLLELGRGVLDQQ |
|---|
| Other Names | dJ221C16.10.1, hemochromatosis, hereditary hemochromatosis protein, hereditary hemochromatosis protein HLA-H, HH, high Fe, HLAH, HLA-HHFE1, MGC103790, MHC class I-like protein HFE, MVCD7 |
|---|
| Gene, Accession # | HFE, Gene ID: 3077, Accession: NP_000401, SwissProt: NP_000401 |
|---|
| Catalog # | H00003077-M01 |
|---|
| Price | |
|---|
| Order / More Info | HFE Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 23991213 |
|---|
| 产品资料 |
|
|