| Edit |   |
|---|
| Antigenic Specificity | HFM1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The HFM1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to HFM1. This antibody reacts with human. The HFM1 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:FVGLDIQQKLTVFYLEPKRFGNQITMQRKSETQISHSKHSDISTIAGPNKGTTASKKPGNRECNHLCK |
|---|
| Other Names | FLJ39011, helicase-like protein HFM1, HFM1, ATP-dependent DNA helicase homolog (S. cerevisiae), probable ATP-dependent DNA helicase HFM1, RP11-539G11.1 |
|---|
| Gene, Accession # | HFM1, Gene ID: 164045 |
|---|
| Catalog # | NBP1-81954 |
|---|
| Price | |
|---|
| Order / More Info | HFM1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|