| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | H1FOO |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The H1FOO Antibody from Novus Biologicals is a rabbit polyclonal antibody to H1FOO. This antibody reacts with human. The H1FOO Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human H1FOO antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: YRKTKAESKSSKPTASKVKNGAASPTKKKVVAKAKAPKAGQGPNTKAAAPAKGSGSKVVPAHLSRKTEAPKGPRKAGLPIKASSSKVSSQ |
|---|
| Other Names | H1 histone family, member O, oocyte-specific, H1OO, histone H1oo, MGC50807, Oocyte-specific histone H1, Oocyte-specific linker histone H1, osH1 |
|---|
| Gene, Accession # | H1FOO, Gene ID: 132243 |
|---|
| Catalog # | NBP1-86265 |
|---|
| Price | |
|---|
| Order / More Info | H1FOO Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|