| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TSSC3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TSSC3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TSSC3. This antibody reacts with human. The TSSC3 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence. |
|---|
| Immunogen | Synthetic peptides corresponding to PHLDA2(pleckstrin homology-like domain, family A, member 2) The peptide sequence was selected from the middle region of PHLDA2. Peptide sequence QNRRALQDFRSRQERTAPAAPAEDAVAAAAAAPSEPSEPSRPSPQPKPRT. |
|---|
| Other Names | Beckwith-Wiedemann syndrome chromosomal region 1 candidate gene C protein, BWR1Cp17-Beckwith-Wiedemann region 1 C, HLDA2BRW1C, Imprinted in placenta and liver protein, IPLp17-BWR1C, pleckstrin homology-like domain family A member 2, pleckstrin homology-like domain, family A, member 2, TSSC3p17-Beckwith-Wiedemann region 1C, tumor suppressing subchromosomal transferable fragment cDNA 3, tumor suppressing subtransferable candidate 3, Tumor-suppressing STF cDNA 3 protein, Tumor-suppressing subchromosomal transferable fragment candidate gene 3 protein, tumor-supressing STF cDNA 3 |
|---|
| Gene, Accession # | PHLDA2, Gene ID: 7262, Accession: Q53GA4, SwissProt: Q53GA4 |
|---|
| Catalog # | NBP1-59088 |
|---|
| Price | |
|---|
| Order / More Info | TSSC3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 29156746 |
|---|
| 产品资料 |
|
|