| 产品详情 |
| Edit |   |
| Antigenic Specificity | TSSK1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TSSK1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TSSK1. This antibody reacts with human. The TSSK1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human TSSK1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KSATKLEPEGEAQPQAQPETKPEGTAMQMSRQSEILGFPSKPSTMETEEGPPQQPPETR |
| Other Names | EC 2.7.11, serine/threonine kinase 22D (spermiogenesis associated), Serine/threonine-protein kinase 22A, spermiogenesis associated 4, SPOGA1, SPOGA4EC 2.7.11.1, STK22A, STK22DFKSG81, Testis-specific kinase 1, testis-specific serine kinase 1, testis-specific serine kinase 1B, testis-specific serine/threonine-protein kinase 1, TSK-1, TSSK-1, TSSK1serine/threonine kinase FKSG81 |
| Gene, Accession # | TSSK1B, Gene ID: 83942 |
| Catalog # | NBP1-83883 |
| Price | |
| Order / More Info | TSSK1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|