| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | HGF |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The HGF Antibody from Novus Biologicals is a rabbit polyclonal antibody to HGF. This antibody reacts with human. The HGF Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human HGF antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GPWCYTGNPLIPWDYCPISRCEGDTTPTIVNLDHPVISCAKTKQLRVVNGIPTRTNIGWMVSLRYRNKHICGGSLIKESWVLTARQCFPSRDLKDYEA |
|---|
| Other Names | deafness, autosomal recessive 39, DFNB39, EC 3.4.21, EC 3.4.21.7, fibroblast-derived tumor cytotoxic factor, F-TCF, hepatocyte growth factor (hepapoietin A; scatter factor), Hepatopoeitin-A, HGFB, HPTAhepatocyte growth factor, lung fibroblast-derived mitogen, Scatter factor, SFhepatopoeitin-A |
|---|
| Gene, Accession # | HGF, Gene ID: 3082 |
|---|
| Catalog # | NBP2-48806 |
|---|
| Price | |
|---|
| Order / More Info | HGF Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|