| Edit |   |
| Antigenic Specificity | IGFBP-5 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | Protein A purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunocytochemistry/Immunofluorescence. ICC/IF Fixation/Permeabilization: PFA/Triton X-100 |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The IGFBP-5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to IGFBP-5. This antibody reacts with human. The IGFBP-5 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: DRRKKLTQSKFVGGAENTAHPRIISAPEMRQESEQGPCRRHMEASLQELKASPRMV |
| Other Names | IBP5IBP-5, IGF-binding protein 5, IGFBP-5, insulin-like growth factor binding protein 5, insulin-like growth factor-binding protein 5 |
| Gene, Accession # | IGFBP5, Gene ID: 3488 |
| Catalog # | NBP2-68755 |
| Price | |
| Order / More Info | IGFBP-5 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |