| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | POLD3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The POLD3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to POLD3. This antibody reacts with human. The POLD3 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human POLD3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SVTEPKLATPAGLKKSSKKAEPVKVLQKEKKRGKRVALSDDETKETENMRKKRRRIKLPESDSSEDEVFPDSPGAY |
|---|
| Other Names | DNA polymerase delta subunit 3, DNA polymerase delta subunit p66, DNA polymerase delta, subunit 3, KIAA0039MGC119643, MGC119642, P66, P68, polymerase (DNA directed), delta 3, polymerase (DNA-directed), delta 3, accessory subunit |
|---|
| Gene, Accession # | POLD3, Gene ID: 10714, Accession: Q15054, SwissProt: Q15054 |
|---|
| Catalog # | NBP2-38862 |
|---|
| Price | |
|---|
| Order / More Info | POLD3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|