| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | POLE4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The POLE4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to POLE4. This antibody reacts with human. The POLE4 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human POLE4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VPGARLSRLPLARVKALVKADPDVTLAGQEAIFILARAAELFVETIAKDAYCCAQQGKRKTLQRRDLDNAIEAVDEFAFLEGTL |
|---|
| Other Names | DNA polymerase epsilon p12 subunit, DNA polymerase epsilon subunit 4, DNA polymerase epsilon subunit p12, DNA polymerase II subunit 4, EC 2.7.7.7, p12, polymerase (DNA-directed), epsilon 4 (p12 subunit), YHHQ1 |
|---|
| Gene, Accession # | POLE4, Gene ID: 56655 |
|---|
| Catalog # | NBP2-54947 |
|---|
| Price | |
|---|
| Order / More Info | POLE4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|