| Edit |   |
|---|
| Antigenic Specificity | CCBE1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CCBE1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CCBE1. This antibody reacts with mouse. The CCBE1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the C terminal of human Ccbe1The immunogen for this antibody is Ccbe1. Peptide sequence RGAPGPPGSPGPPGSFDFLLLVLADIRNDIAELQEKVFGHRTHSSAEDFP. |
|---|
| Other Names | collagen and calcium binding EGF domains 1, collagen and calcium-binding EGF domain-containing protein 1, Full of fluid protein homolog, KIAA1983FLJ30681, MGC50861 |
|---|
| Gene, Accession # | CCBE1, Gene ID: 147372, Accession: NP_848908 |
|---|
| Catalog # | NBP1-79501-20ul |
|---|
| Price | |
|---|
| Order / More Info | CCBE1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|