| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CC Chemokine Receptor D6 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CC Chemokine Receptor D6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CC Chemokine Receptor D6. This antibody reacts with human. The CC Chemokine Receptor D6 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human CC Chemokine Receptor D6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QYLKAFLAAVLGWHLAPGTAQASLSSCSESSILTAQEEMTGMNDLGERQSENYPNKEDVGNKSA |
|---|
| Other Names | C-C chemokine receptor D6, CCR10CCR9D6CC-chemokine-binding receptor JAB61, chemokine (C-C) receptor 9, chemokine binding protein 2, Chemokine receptor CCR-10, Chemokine receptor CCR-9, chemokine receptor D6, chemokine-binding protein 2, Chemokine-binding protein D6, CMKBR9chemokine (C-C motif) receptor 9, hD6, MGC126678, MGC138250 |
|---|
| Gene, Accession # | CCBP2, Gene ID: 1238 |
|---|
| Catalog # | NBP1-88150 |
|---|
| Price | |
|---|
| Order / More Info | CC Chemokine Receptor D6 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|