| Edit |   |
| Antigenic Specificity | CUTC |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CUTC Antibody from Novus Biologicals is a rabbit polyclonal antibody to CUTC. This antibody reacts with human. The CUTC Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to CUTC(cutC copper transporter homolog (E. coli)) The peptide sequence was selected from the middle region of CUTC. Peptide sequence LEGLPLIKRLIEQAKGRIVVMPGGGITDRNLQRILEGSGATEFHCSARST. |
| Other Names | CGI-32, copper homeostasis protein cutC homolog, cutC copper transporter homolog (E. coli), RP11-483F11.3 |
| Gene, Accession # | CUTC, Gene ID: 51076, Accession: Q9NTM9, SwissProt: Q9NTM9 |
| Catalog # | NBP1-56858 |
| Price | |
| Order / More Info | CUTC Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |