| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MSX1 |
|---|
| Clone | 1E2 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunoprecipitation. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MSX1 Antibody (1E2) from Novus Biologicals is a mouse monoclonal antibody to MSX1. This antibody reacts with human, mouse. The MSX1 Antibody (1E2) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunoprecipitation. |
|---|
| Immunogen | MSX1 (NP_002439 216 a.a. - 297 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NRRAKAKRLQEAELEKLKMAAKPMLPPAAFGLSFPLGGPAAVAAAAGASLYGASGPFQRAALPVAPVGLYTAHVGYSMYHLT |
|---|
| Other Names | Homeobox protein Hox-7, homeobox protein MSX-1, HOX7homeobox 7, HYD1msh homeobox homolog 1 (Drosophila), msh (Drosophila) homeo box homolog 1 (formerly homeo box 7), msh homeo box 1, msh homeobox 1, Msh homeobox 1-like protein, msh homeobox homolog 1, OFC5, STHAG1 |
|---|
| Gene, Accession # | MSX1, Gene ID: 4487, Accession: NP_002439, SwissProt: NP_002439 |
|---|
| Catalog # | H00004487-M11 |
|---|
| Price | |
|---|
| Order / More Info | MSX1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|