| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MSX2 |
|---|
| Clone | 1F6 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. It has been used for IHC-P. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MSX2 Antibody (1F6) from Novus Biologicals is a mouse monoclonal antibody to MSX2. This antibody reacts with human. The MSX2 Antibody (1F6) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | MSX2 (NP_002440, 101 a.a. - 201 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TASVKSENSEDGAAWMQEPGRYSPPPRHMSPTTCTLRKHKTNRKPRTPFTTSQLLALERKFRQKQYLSIAERAEFSSSLNLTETQVKIWFQNRRAKAKRL* |
|---|
| Other Names | CRS2parietal foramina 1, FPP, Homeobox protein Hox-8, homeobox protein MSX-2, HOX8msh homeobox homolog 2 (Drosophila), MSH, msh (Drosophila) homeo box homolog 2, msh homeo box 2, msh homeobox 2, msh homeobox homolog 2, PFM, PFM1 |
|---|
| Gene, Accession # | MSX2, Gene ID: 4488, Accession: NP_002440, SwissProt: NP_002440 |
|---|
| Catalog # | H00004488-M04 |
|---|
| Price | |
|---|
| Order / More Info | MSX2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 20923449 |
|---|
| 产品资料 |
|
|