| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | FMO2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FMO2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to FMO2. This antibody reacts with human, mouse. The FMO2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human, mouse FMO2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: IFPTAELQARWVTRVFKGLCSLPSERTMMMDIIKRNEKRIDLFGESQSQTLQTNYVDYLDELALEIGAKPDFCSLLFKDPKLAVRLYFGPCN |
|---|
| Other Names | dimethylaniline monooxygenase [N-oxide-forming] 2, Dimethylaniline oxidase 2, EC 1.14.13.8, flavin containing monooxygenase 2, flavin containing monooxygenase 2 (non-functional), FLJ40826, FMO 1B1, FMO 2, FMO, pulmonary, FMO1B1, Pulmonary flavin-containing monooxygenase 2 |
|---|
| Gene, Accession # | FMO2, Gene ID: 2327 |
|---|
| Catalog # | NBP1-85952 |
|---|
| Price | |
|---|
| Order / More Info | FMO2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|