| Edit |   |
|---|
| Antigenic Specificity | FMO5 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FMO5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to FMO5. This antibody reacts with human. The FMO5 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry. |
|---|
| Immunogen | Synthetic peptides corresponding to FMO5(flavin containing monooxygenase 5) The peptide sequence was selected from the middle region of FMO5. Peptide sequence NKYLEKKINQRFDHEMFGLKPKHRALSQHPTLNDDLPNRIISGLVKVKGN. |
|---|
| Other Names | dimethylaniline monooxygenase [N-oxide-forming] 5, Dimethylaniline oxidase 5, EC 1.14.13.8, flavin containing monooxygenase 5, FMO 5, Hepatic flavin-containing monooxygenase 5 |
|---|
| Gene, Accession # | FMO5, Gene ID: 2330, Accession: P49326, SwissProt: P49326 |
|---|
| Catalog # | NBP1-59731-20ul |
|---|
| Price | |
|---|
| Order / More Info | FMO5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|