| Edit |   |
| Antigenic Specificity | FMO5 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The FMO5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to FMO5. This antibody reacts with human. The FMO5 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry. |
| Immunogen | Synthetic peptides corresponding to FMO5(flavin containing monooxygenase 5) The peptide sequence was selected from the middle region of FMO5. Peptide sequence NKYLEKKINQRFDHEMFGLKPKHRALSQHPTLNDDLPNRIISGLVKVKGN. |
| Other Names | dimethylaniline monooxygenase [N-oxide-forming] 5, Dimethylaniline oxidase 5, EC 1.14.13.8, flavin containing monooxygenase 5, FMO 5, Hepatic flavin-containing monooxygenase 5 |
| Gene, Accession # | FMO5, Gene ID: 2330, Accession: P49326, SwissProt: P49326 |
| Catalog # | NBP1-59731 |
| Price | |
| Order / More Info | FMO5 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |