| 产品详情 |
| Edit |   |
| Antigenic Specificity | SSH3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SSH3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SSH3. This antibody reacts with human. The SSH3 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human SSH3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MKQYECSLEQALRHVQELRPIARPNPGFLRQLQIYQGILTASRQSHVWEQKVGGVSPEEHPAPEVSTPFPPLPPEPE |
| Other Names | EC 3.1.3.16, EC 3.1.3.48, FLJ10928, FLJ20515, FLJ42240, hSSH-3L, protein phosphatase Slingshot homolog 3, slingshot 3, slingshot homolog 3 (Drosophila), SSH3, SSH3L, SSH-3L, SSH-like protein 3 |
| Gene, Accession # | SSH3, Gene ID: 54961 |
| Catalog # | NBP1-83805 |
| Price | |
| Order / More Info | SSH3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|