| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SSR2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SSR2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SSR2. This antibody reacts with human. The SSR2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. This product is specific to Subunit or Isoform: beta |
|---|
| Immunogen | Synthetic peptides corresponding to SSR2(signal sequence receptor, beta (translocon-associated protein beta)) The peptide sequence was selected from the N terminal of SSR2. Peptide sequence SFVVLALFAVTQAEEGARLLASKSLLNRYAVEGRDLTLQYNIYNVGSSA |
|---|
| Other Names | DKFZp686F19123, Signal sequence receptor subunit beta, signal sequence receptor, beta (translocon-associated protein beta), SSR-beta, TLAP, translocon-associated protein beta, translocon-associated protein subunit beta, TRAP-beta, TRAPBTRAP-BETA |
|---|
| Gene, Accession # | SSR2, Gene ID: 6746, Accession: P43308, SwissProt: P43308 |
|---|
| Catalog # | NBP1-69471 |
|---|
| Price | |
|---|
| Order / More Info | SSR2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 24218363 |
|---|
| 产品资料 |
|
|